DPCstruct | MC58833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4NUK8 | 28-135 | QQIFTEDNRVAHVAEYEGQPGRRPLTFDEVQALFDAVDARVEQTQALGRKGSLTARRDAALLKTIYAFGLRRNEARMLDLGDLRRPP… |
| A0A7W3M3N9 | 3-93 | HTLEYEGDPRRRPLTYDEVQALFDAADARPAQIRGHGRKGTLTALRDAAVVKTIYAYGTRRTESSMVDLVDLQRHRKSPQCGQFGSL… |
| A0A1C6W4Q9 | 80-186 | None |
| A0A4V2YDS4 | 51-164 | None |
| H2K4X0 | 10-101 | None |
| A0A7Z6TIT3 | 24-115 | None |
| A0A839G7K2 | 130-229 | None |
| A0A0K8Q939 | 85-207 | None |
| A0A7W8EY22 | 2-96 | None |
| A0A7X5VHJ2 | 13-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.