DPCstruct | MC58832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 495 |
|---|---|
| Mean domain length (aa) | 182 ± 34 aa |
| Standard deviation of domain lengths | 33.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.79 |
| Pfam Score | 93.84 |
| Assigned Pfam label(s) | CL0072- PF02601- CL0260- CL0237- CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A291B9R9 | 56-243 | PSFRAINVSQPYQTLAKLYNIAPQAQQELENLTHQIAHHVNGTVHSSGLKEKTRAEEKIVGELAGDASKLTDIARITVEVDSVEGLI… |
| A0A512A8X4 | 10-192 | FLDPYIQAVGELKIKLRGIRKQYRKQQRHSPIEFVTGRVKHIESIKEKMELRGITEENLAQEMQDIAGLRVMVQFVDDVDEVLEVLR… |
| A0A7X8FS07 | 9-165 | None |
| A0A7Y0JSJ9 | 32-178 | None |
| A0A0B8PE19 | 2-130 | None |
| A0A0E2NF54 | 7-189 | None |
| A0A6G3VC00 | 2-137 | None |
| A0A0Q7S922 | 8-206 | None |
| A0A450TAI5 | 398-589 | None |
| A0A7S2C779 | 14-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.