DPCstruct | MC5883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 59.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446PXW7 | 2-112 | SFYFVYLRLDWLWSLNLFALILLNFLEKPLWCRKDALHACDQRDLYFLGQLPYFSKTESLIYEGLTLVILVMDIFCPLSYEGLNIFW… |
| A0A7J0DRV3 | 1-134 | MNAEDGIGLPEQILDQSNYESAAKFYFIFIRFDFLWTLNYFALIVLNFVEKPLWCAKYSGHPCSDRDYYYLGQLPYLTSAESLVYEG… |
| A0A2G5EHY6 | 66-201 | None |
| M7Z916 | 80-209 | None |
| F6H5D1 | 46-181 | None |
| A0A444Y6D2 | 44-170 | None |
| A0A6A5NIA2 | 64-190 | None |
| A0A7J7HGF7 | 46-164 | None |
| A0A444ZFN7 | 1-130 | None |
| M1BKD0 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.