DPCstruct | MC58824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09834 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0U661 | 1-66 | MEDYRVRSIVKTISWRVLATLATMFIVFAFTGKVKLSVGIGLVEAVSKMVLYYLHERTWGKISWGK |
| A0A2E1Y437 | 1-68 | METHARSLAKAISWRVTGTLDTMIISLVITGSFKLAAAIGFTEVATKSVLYYLHERAWLKVPLGRRRP |
| A0A537NGR5 | 6-75 | None |
| A0A524ICE4 | 4-75 | None |
| A0A2D5MNW7 | 5-75 | None |
| A0A2N3V0Y6 | 12-97 | None |
| A0A2U2XAH5 | 15-84 | None |
| A0A7S1D6H6 | 34-103 | None |
| A0A7C7WST0 | 1-88 | None |
| A0A7V4IAC8 | 25-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.