DPCstruct | MC58820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8TFN0 | 16-102 | QRERPGQRTHLSASGLRARGWTPAMVRQLLGEPDLLLAHPQFRSAPQTRLYRVERVAAAERGEAFRVAAAAAVRRSATARASALRRR |
| D6STS0 | 1-83 | MKDYINLAQLKRRGWTIKLIADFKPEHDSEADNPINPAWAPQKLYDLDKIKAIEATPEFQGRKKWANWFQGHMKELARQRKEA |
| A0A6N7FR23 | 23-117 | None |
| A0A4R7H821 | 14-103 | None |
| A0A4R9LUJ0 | 30-115 | None |
| A0A4U1KPG6 | 1-79 | None |
| A0A428Z291 | 23-112 | None |
| A0A519QBG3 | 2-99 | None |
| A0A5C4XGE3 | 8-96 | None |
| A0A1Y2NQN2 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.