DPCstruct | MC5882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9FH76 | 1-163 | MASSSSQNKPETINLNDTPSVMPEVWRPYFLSINGPVSVTDSVMLNGETATAVAAGLCTPEDAKVLAGRTDPQIINESLALTIQCTA… |
| A0A7J0DPS2 | 1-131 | MASSSQNNFDLNAVPNVQPKIRCSSFLSQKGPLMTSGSVMLDDDIAASVAKGIITPLDEKLLADRTDDEAINESMALSIQCASSVSN… |
| E4Z8N9 | 190-332 | None |
| A0A2N9H7Z9 | 1-141 | None |
| A0A5N5FL60 | 103-249 | None |
| A0A5N5EYF7 | 125-243 | None |
| A0A2N9I7X9 | 1-127 | None |
| A0A5N5I488 | 1-159 | None |
| G0XZD0 | 1-113 | None |
| A0A5N5G6Q7 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.