DPCstruct | MC58816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12675 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8GAJ2 | 53-205 | SARATQQRDGTMELRYDSYCGLYCGACPVLRANRDGRVEEVAGEWKMKPEDLRCHGCKTETLSSFCTSCDIKKCAEDEDVEFCFDCS… |
| A0A3N5XPW6 | 11-150 | YDKRLAAVCGLFCKACSIYIGSTEDPEKLKPIAVAVGKKPDEIRCLGCRSDVRFFYCQTCTLYKCAASRGIDFCGSCESYPCEDLKE… |
| A0A1G1AII2 | 8-103 | None |
| A0A1G1A0Y3 | 43-169 | None |
| A0A356C2K3 | 157-290 | None |
| A0A1F9BED6 | 1-126 | None |
| A0A7X9H0A7 | 1-134 | None |
| A0A7V3Y1R6 | 6-125 | None |
| R9MKD3 | 132-257 | None |
| A0A1W9QRL7 | 23-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.