DPCstruct | MC58815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511D334 | 139-196 | VDLDDTVRQTYGYAKQGAGRGHTGVKGLTALLAVLSTPVSAPVIAATRLRKGSTNSAR |
| A0A4V6PXL0 | 107-170 | TERVLVDIDDSIIEVHGHGKQGSGYGYSGVRGWNSLITTVTTGATAPVIVGQRLRKGSCGSSRG |
| A0A7K3ECB3 | 54-118 | None |
| A0A4Y8JLE1 | 13-81 | None |
| A0A7Y9L7X2 | 20-82 | None |
| X8C3C3 | 25-89 | None |
| A0A378SNL8 | 70-139 | None |
| A0A6P1ICH1 | 115-170 | None |
| A0A6H3JQI7 | 21-80 | None |
| A0A2S1Z239 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.