DPCstruct | MC58813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 74 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 94.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.17 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0734- CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0PPQ8 | 23-86 | AWRRVVATAVTYGVPVPAFASALAYYDSYRSATLPANLLQAQRDYFGAHTFKRVDRDGVFHFQW |
| A0A379T8N6 | 2-59 | AYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRTDKDGIFHTEW |
| A0A4Y7KUV3 | 253-330 | None |
| A0A378W1T3 | 28-129 | None |
| A0A250IX46 | 14-81 | None |
| A0A0G0A7T6 | 369-458 | None |
| A0A507FAL0 | 685-766 | None |
| A0A7V9HWI4 | 2-57 | None |
| A0A183NVW3 | 1-71 | None |
| A0A5A7V1S9 | 5-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.