DPCstruct | MC58809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 185 |
|---|---|
| Mean domain length (aa) | 183 ± 32 aa |
| Standard deviation of domain lengths | 32.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0JKM5 | 8-166 | GRLVDGVTVPAAGAPFFTWDPVLRGSPNRPWRRVGSDRLVRTLMRVLTEFAAAHPDAPRIGIGDLSRPGGGDFGVRYGRPGHVSHQN… |
| A0A832PV17 | 56-259 | AIEFTTPTGQFIKMSFRSPAKSVGKVNDGHILNGKCLRPLGPGYKLREPELGCATDEVINLMMFSIGEVLRAFPDSPALVLGTLSKK… |
| A0A517YX92 | 217-395 | None |
| A0A3B9YKM1 | 379-544 | None |
| A0A7W0PAF6 | 32-217 | None |
| A0A2G9N4Y8 | 492-696 | None |
| A0A7I0HWF1 | 539-706 | None |
| A0A3G8XKV3 | 4-116 | None |
| X0S9V3 | 228-426 | None |
| A0A3C1EPX1 | 257-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.