DPCstruct | MC58807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 309 ± 60 aa |
| Standard deviation of domain lengths | 59.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.40 |
| Pfam Score | 64.03 |
| Assigned Pfam label(s) | CL0534- CL0364- PF21168- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357XTG8 | 69-420 | FEHKLAFANIFLADLSKKQLVRWMFRELDEIFIVPTSSPVMTYIPQCPADGSLIAVEIFAIAGFERNRGLTCRDASITIEKRGVRWC… |
| W7WB17 | 2-239 | QALAQRAYQDVFATLAHTGCEHLLRLWNYLPDINGDGGGLERYRQFNLGRQQAFFDAQRPAFEGAPAACALGTQGGPFCVHFLAGRT… |
| A0A2E7RTV3 | 818-1162 | None |
| A0A522GBP4 | 1-246 | None |
| A0A0G4M0B7 | 13-250 | None |
| A0A7W1P5Y4 | 4-195 | None |
| A0A3D9LUQ9 | 26-337 | None |
| R1BR72 | 9-366 | None |
| A0A1T4LEV6 | 169-534 | None |
| A0A7V2V1L8 | 244-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.