DPCstruct | MC58803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 170 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7LZN3 | 123-291 | MEFRSDALWEHYISWESGHNRLQRALAIYDRILKTPTQLYFQNWDSFKKLIEENKPEDVLSSTEFVGLLARVAPVAATALRISMKAA… |
| A0A2D4M796 | 2-162 | YINWENEEGNLRAVTTIFDRILGIPTQLYSHHFQRFKDHVQNNLPRDILTTEQFIQLRREIASTANNHNGEDEPPEDNQPSGIEDIT… |
| A0A6P8DXV1 | 68-249 | None |
| F1L4L7 | 1-177 | None |
| A0A8B6HNX5 | 128-331 | None |
| A0A453BDL6 | 112-269 | None |
| A0A453MU18 | 2-180 | None |
| A0A835UKB0 | 138-321 | None |
| A0A2P4VFL3 | 487-703 | None |
| A0A6P6B309 | 234-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.