DPCstruct | MC58802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 365 |
|---|---|
| Mean domain length (aa) | 298 ± 70 aa |
| Standard deviation of domain lengths | 70.29 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.06 |
| Pfam Score | 99.35 |
| Assigned Pfam label(s) | CL0238- CL0016- PF15477- PF02536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6QAA7 | 56-372 | LGHPKNYIEVLTKWGFSESDIRKISVRRPSLRKADVAHLQSKLNTLNGLGISGTDLVKIINCRPRLLNCRINQSFDEQLKFLVTLFE… |
| A0A7J7VEE8 | 6-225 | DIKQILLFLKDLGIEDNQLGPFLTKNYAIFSEDLENLKTRVAYLQSKNFNKADITQMVRNAPFLLNFSVERLDNRLGFFQKELELSV… |
| A0A4Y7KTQ4 | 4-192 | None |
| A0A4Y7L8N6 | 236-585 | None |
| A0A4Y7LBX3 | 2-202 | None |
| A0A1R3JSN0 | 64-393 | None |
| A0A0D9XQ62 | 374-796 | None |
| A0A4Y7KTP2 | 11-426 | None |
| A0A6H5LJY6 | 258-600 | None |
| A0A4Y7KSE7 | 20-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.