DPCstruct | MC58801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 574 ± 70 aa |
| Standard deviation of domain lengths | 69.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11885 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6KYZ4 | 4-605 | PKGYPAADVGSWEAVGLDENVCFDRVGRLGPYGLDTDLPASGGKARSAVAWDKVQWGKLQDECVLRNKLRYEDSAVPSLRPGKNEPG… |
| A0A0G2HRC5 | 56-630 | KRWVPEQLQESADVKVADKIPLQPAVVNPYAHLDGVQTCFLDNEGTVPAPDIISYPGIPANMPAPYFGGYEELGLAPNQCFERFGRL… |
| A0A179HHV3 | 364-1038 | None |
| A0A4Q4UZE7 | 496-988 | None |
| A0A094HSS2 | 288-938 | None |
| A0A2H4SKU5 | 431-1091 | None |
| C9SIE6 | 50-670 | None |
| A0A6A6PJN0 | 90-737 | None |
| G0S341 | 434-1035 | None |
| A0A4S9ESN3 | 31-615 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.