DPCstruct | MC58800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 24.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6KXP3 | 75-255 | VFPDFPPWPPQQVLADRISYMTHIRARTSDIPKGHEEDSPLYSLYRLYERLVLDDTVGYRNEIEYFWRHRDWPVCEIPDPRDPNAAR… |
| A0A6J3LXF7 | 33-206 | NELSPAPRTLIANRVNCEIFYLEREVDRDYDTPLAALYRMYEHLVLDQSIEIRNEIEHIWFMRWPVRDLPDPHDPDPERYACLACLP… |
| A0A4Y8DEA2 | 67-250 | None |
| E4UZR7 | 36-220 | None |
| A0A094JNH2 | 759-929 | None |
| A0A4Q4Y5T8 | 56-225 | None |
| A0A2S7P768 | 11-122 | None |
| A0A6P8AZT1 | 3-136 | None |
| A0A5J5EIJ2 | 255-426 | None |
| A0A167YGW5 | 35-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.