DPCstruct | MC5880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 470 ± 86 aa |
| Standard deviation of domain lengths | 85.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0020- PF12842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0C4N6 | 2-462 | NLYGILKTDDLITRFFRQATQFCIDLVYRIFNDPSHTPVQAKTKIFHWIDAFVHLIALLVRHSGESGNPTTKINLLNKVLGIVLGIL… |
| A0A7J0DHR1 | 2-442 | LFAEWYRICELPGTNDAACAHYILQLQQSGLLKGDDISDRFFRCLTELSVSHCLSSEVISSGPLQSPQQVHPLSFLAIDIYAKLVFS… |
| A0A3N6QNJ1 | 458-1055 | None |
| A0A7I8XIY1 | 705-1184 | None |
| A0A1C6YB95 | 161-640 | None |
| F6GV61 | 179-758 | None |
| A0A0B1PJD4 | 435-943 | None |
| A0A7R9PC25 | 212-647 | None |
| B8CC81 | 2-296 | None |
| A0A1I7ZGD4 | 677-1207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.