DPCstruct | MC588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7WQ20 | 9-104 | LILNLLVAARGDRSAPCCEVCESGKEHYYSIPSPDEPNAQCGETCMMPSRFKFWKLFEPKLSKGTCASKGFTKYVSTETDGVWPLAN… |
| A0A1Y2DDH8 | 13-104 | LLLSTVIAKETCCEVCPVGKEKYYSIDLKYNRCGECCMKSRDYWIFHIFEKGLKKAENEHPCSELGYNKYLETETHGALFIKMTLDK… |
| A0A482ULV0 | 15-101 | None |
| A0A7S0J1I7 | 562-664 | None |
| A0A6C0JZX3 | 14-97 | None |
| A0A7S4R319 | 154-233 | None |
| A0A7S1F505 | 2-111 | None |
| A0A1Q9EHC7 | 680-781 | None |
| A0A813F1U4 | 266-350 | None |
| A0A7R9UZB1 | 59-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.