DPCstruct | MC58799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 363 ± 69 aa |
| Standard deviation of domain lengths | 69.39 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2TJV8 | 26-450 | LLDHRDSRAALVRGIRLHYHFAMSEPVIRLSSSMPLVARARNARLIMSNEIPERMAPQEHPYCIWYPDFATEDTYRSLASKYPDMRY… |
| A0A5N6KWK3 | 522-934 | ACLAALRGEAVPHALGDPVHRLCVIRGIRYHPSFGSELHGVLPVFTRALNARSIMSNVIPDFDSPDAVPYCIWHPQVASEQTYRQLV… |
| A0A1J7JIV6 | 6-357 | None |
| A0A1L9VNM6 | 335-776 | None |
| F2RWX5 | 33-450 | None |
| A0A3D8RKH9 | 1-231 | None |
| A0A178EPR3 | 379-821 | None |
| A0A1J7I587 | 16-318 | None |
| G4UQ13 | 367-774 | None |
| A0A1E3B3R3 | 7-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.