DPCstruct | MC58795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 557 ± 88 aa |
| Standard deviation of domain lengths | 88.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6KQW8 | 430-1050 | ARPGGPTFPSSSDSDEQRASVLLLCEIRIMAFVQELQALITALSLTARAKPSNNLAPGLCSIVRQARSDSQVNISSVALEQDLEWVL… |
| Q386P2 | 173-827 | ALASRSREALLHISRNPTVTKLLTERPGILSELEAPAKQLRSLEDLVLLLRELNTSPVGDRLRFLNGASPTLVEVFGEENVKDPQAI… |
| A0A0P0VYT9 | 4-448 | None |
| T5AJC4 | 22-578 | None |
| A0A817RKH8 | 18-391 | None |
| A0A261Y8D4 | 139-770 | None |
| B7G9U0 | 109-786 | None |
| A0A4Y9YQ66 | 52-682 | None |
| A0A4Z0A7P5 | 236-822 | None |
| A0A1V8URA2 | 572-1214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.