DPCstruct | MC58793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 290 ± 51 aa |
| Standard deviation of domain lengths | 51.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0XER1 | 76-327 | DIPNASSRLQPPLEIPGPSAYQVHSPVQHSPQASLDWQAPDEEDLSQVWRTETQETQETQSTVSYAGMQRKPSVSTPQNSGLFLQSS… |
| A0A0F4YVS1 | 476-695 | VWGSVYSERTSERNIPTHARTASSVISGHSSNSSTSGTTLPIPISSGTSMSLYLPCEENNYAGFCKGAWKLQVGLKKKAFSIRMRPA… |
| A0A178EWR0 | 848-1095 | None |
| M2N211 | 160-488 | None |
| A0A0A2LBU7 | 61-345 | None |
| A0A2B7WUW5 | 398-699 | None |
| A0A6G1G4I2 | 1-246 | None |
| A0A151GQQ6 | 243-513 | None |
| W9IBA1 | 125-427 | None |
| R7YUP7 | 159-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.