DPCstruct | MC5879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 172 ± 30 aa |
| Standard deviation of domain lengths | 30.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HTN9 | 57-202 | SQARLDTIVEVLDLVLAQLCDVIVEQLRDRVVTGLLQASLDGLVRVILDGGPTRIFSPNDAPLLEEDLEILKEFFISGGDGLPRGTV… |
| A0A7J0DHP0 | 26-178 | QNLTIISDSVHERVRTRIIADVMKASFDGSCWFCLRASRAFTRQDSQIIEDDFKSLKDLFWANGDGLPADLINKFSTTVREVLPLFR… |
| A0A7J7M961 | 6-138 | None |
| A3C5M6 | 135-263 | None |
| U5DD15 | 900-1121 | None |
| B7ZXY1 | 407-571 | None |
| A0A2P5XV53 | 206-363 | None |
| A0A2P6MP23 | 805-989 | None |
| A0A1S3Z7D2 | 110-289 | None |
| A0A7J7KUC3 | 169-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.