DPCstruct | MC58781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 343 ± 58 aa |
| Standard deviation of domain lengths | 57.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284S6C0 | 19-387 | SSLRSVPNISSSASSSSSSSSLSIIALQSCLRINPEQPHPRINGCLPSYACRPYTLGFTRLHKGKSPNREFIQDAQNWMVNILEPGS… |
| A0A409YAY2 | 52-335 | DARPEHRESLVGNKRLAMIRKLRDTDTGNVYYMFDGEDEGTCRWRLAVRTATHALLVCRLPEDMSITEVATYLVEHGIAMQTLQKST… |
| A0A2H3BML3 | 537-934 | None |
| A0A4S8MMV1 | 182-497 | None |
| A0A2H3CHJ4 | 5-209 | None |
| A0A4Q9N7A2 | 41-307 | None |
| A0A369JHL3 | 46-363 | None |
| A0A369J9N7 | 166-622 | None |
| A0A401GYR7 | 7-321 | None |
| A0A5C3LS44 | 374-632 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.