DPCstruct | MC58780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284S5J1 | 1-94 | MLSQQFHDPASKEIHEKRMFDLWMGKGPALSYFQELEMEAKKANRRGDDQARGLMVKAVRLGVPNSYTNAIASLEQHIPITYNDWKR… |
| A0A284RNX8 | 499-604 | EKFKDPSVKDKQKVTMYALCMTGSMTTTEYFQEVEKFTKKARLWSDINDRGHMVTALCQGVPASYTSMIANIRIGIPVGYDQWKDHI… |
| A0A284S0X1 | 636-745 | None |
| A0A284RY59 | 1-91 | None |
| A0A284RGZ4 | 202-307 | None |
| A0A284R806 | 643-725 | None |
| A0A284QXW8 | 1-81 | None |
| A0A284S8U8 | 1-110 | None |
| A0A284RDB1 | 35-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.