DPCstruct | MC5878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9KF02 | 5-104 | YRTPLLLERIINWEREFACEVEYLEKPTGLFLGIDFNEKEGYFCTPIDSFSFARTGGDGLHYVLLTDFGLVKDLNEAPVIRISPMDT… |
| A0A5S5CJU1 | 1-115 | MHSDTNYIIPPLLDELMKWEKEIKPHVPYLETPTGYFLKFDPADNGGYQSSPVDAIVFANTGMDGTHYAFLTDFGAVTDLSEAPIIC… |
| A0A544SX82 | 1-110 | None |
| A0A7W5FQR3 | 424-534 | None |
| A0A1V2P7I7 | 1-120 | None |
| A0A0Q9Q027 | 1-102 | None |
| A0A0P7Y6D2 | 5-123 | None |
| A0A1R1AI04 | 105-206 | None |
| M5TW36 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.