DPCstruct | MC58779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 176 ± 23 aa |
| Standard deviation of domain lengths | 23.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369JIU8 | 2-130 | VALRLELNTESDDAPSIASVTSSFATKPSLLPQDIIDRGISELSFVRFTLNEELRMDLESNVRQLQAILDEASSLISERSNTFKIDP… |
| A0A284S466 | 1-196 | MSETDPIDPLQLGDETVVVGDNGKTAMEELWEEYNIHPRVINPETGETSNALSTAYRIEHYGSYDLQAIDVEAHEYERFSNQPRYTL… |
| A0A284R4E6 | 1-193 | None |
| A0A0C9XA04 | 1-185 | None |
| B0DD50 | 144-330 | None |
| B0D6S0 | 218-364 | None |
| A0A0C9Y486 | 123-290 | None |
| A0A0C9XV84 | 1-191 | None |
| A0A4Y9XLQ4 | 141-295 | None |
| A0A146I7Z3 | 243-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.