DPCstruct | MC58778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 168 ± 29 aa |
| Standard deviation of domain lengths | 28.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284S1H0 | 22-163 | TVLLKPYFEPKGADYHMLPLDDLLRQATGLPTEPLRERETRPARIPRATTEGDSKPLIIKIQASVDPQTLESLSGHDFLVYTKKRDL… |
| A0A137Q594 | 514-701 | LPLGELLPVDIGPLSVFEGCATCGEEARSSCAKCDNVQYCSKACQKLDFHAHKSLCRAVSSGTWTTITLESYPWAEPKDPGDRIGVM… |
| A0A7S3PJL9 | 290-451 | None |
| C1MZI8 | 244-446 | None |
| A0A4Q9MRY6 | 104-318 | None |
| A0A7D9L5S7 | 553-728 | None |
| A0A146IB42 | 237-417 | None |
| K0TPJ8 | 202-439 | None |
| A0A166AG00 | 96-276 | None |
| A0A165X1U0 | 691-877 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.