DPCstruct | MC58777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 14 aa |
| Standard deviation of domain lengths | 14.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284RXH3 | 1-128 | MVYELATGNTAVRGLAWDKTRNCLYAATECEYVDCDGRPFGYRWANVPSDLDSTEEQKQEDDNTSEADVRLQPPQCWPKRAYHAEDY… |
| A0A165XQA9 | 406-540 | FIIIGGNKSQQVKIWDARTRTPLYRLSTGNNAVQALAWDGSRNHLFAATDCEYLGYHGTAFGYREAEFGDEDDDYYEEMAWPEKAWH… |
| A0A1C7LMA5 | 408-546 | None |
| A0A1M2W5C8 | 93-227 | None |
| A0A4Y7TJW1 | 169-300 | None |
| A0A0C9V7G4 | 1-118 | None |
| A0A067N4H1 | 83-242 | None |
| M5C8V3 | 26-148 | None |
| A0A7J7PMV8 | 326-463 | None |
| A0A371DWY5 | 17-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.