DPCstruct | MC58771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 21.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284RH03 | 1-149 | MPVSEEEFKDTPYGNIFCWHTMTAKEDIKWTEDNFASPFQCGGEIDKSGHPRRFQGHCNHCVPQGRSGAHKSGLWSVRQTDATDKAA… |
| A0A067SN06 | 365-524 | LKVTRGLGNHVSVEFNILYRWHATVSQTDEAWTEDVFKQAFGDKPFDQLTLADLGQVAAIFADVPPNPAERTFAGIQRGPDGRFSDD… |
| R8BPM7 | 126-289 | None |
| A0A067P9N0 | 299-453 | None |
| A0A4Y9YL29 | 792-968 | None |
| A0A180GGS9 | 1-126 | None |
| A0A2V1B347 | 286-454 | None |
| A0A177U277 | 91-212 | None |
| A0A0N1HTI0 | 357-520 | None |
| A0A430LAP1 | 38-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.