DPCstruct | MC58767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 343 ± 69 aa |
| Standard deviation of domain lengths | 68.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4YAG6 | 5-244 | IREAVAILEELKTKTNVKLDNKIDNSLLYTDYNSNLKLIDNNSNKLTISLKDPINWEIANKLLKDLLKYFNNLLYIIQSQSSSLLLR… |
| W6MQ49 | 8-348 | QLKQIIDDCRKILDLEIAKLKNEYTLERARARASTVNNALEELGKISKLIRAQTTKLGIVFKPPIKDDTVSTATQTLRETIRYVILL… |
| A0A2S4UYA4 | 437-838 | None |
| A0A369S3A3 | 548-936 | None |
| D3BGZ0 | 5-399 | None |
| T1EZG8 | 16-480 | None |
| A0A0K0EJV8 | 2185-2581 | None |
| A0A6P8C981 | 5-243 | None |
| M2REV3 | 292-698 | None |
| A0A5K4F0V3 | 315-709 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.