DPCstruct | MC58763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 156 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357G184 | 1-144 | MIRAIIFMVKVALLVALAVWVADRPGTVAIEWMEYKLTLQMGVFLLLFLLTVLLAIAIFGVIKGVADFPKSFRRYREYVRRDKGYKA… |
| A0A5C9BEF0 | 1-135 | MKFLFWLLLLFALAVAVALASHHSGYMQLVYPPYRIEMSFALFLLLLLALFALAYFALRLALAAARLPATVRRYRAERARDKGRSAM… |
| J6UGW7 | 2-140 | None |
| A0A7Y4YUI9 | 1-166 | None |
| A0A1G0ARX2 | 1-166 | None |
| A0A379AMD5 | 63-207 | None |
| A0A523LCG0 | 1-166 | None |
| B5JT01 | 1-169 | None |
| A0A2A2AKV3 | 1-166 | None |
| A0A3B0SUE1 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.