DPCstruct | MC5876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.59 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF06580- CL0025 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5LXM5 | 12-88 | PYNTVAEEMEYVDAYLYIITQRYGEKFTCRKEIDESLLNYKIPRLIVQPIAENAIEHGMSITREGELVIRLYRKRED |
| A0A5S5BVQ3 | 1-84 | MTSCMSKIFRYSIKKDELVQIGEELDCMQAYMKIISIRYENKFSMDMHVDERLLEMKTPKMILQPIVENSVYHGLERMDQGGRL |
| A0A644T9H1 | 505-591 | None |
| A0A6G3VTZ3 | 1-94 | None |
| A0A1H3FVP9 | 911-998 | None |
| A0A2N1S3Y8 | 737-819 | None |
| A0A1F9I842 | 8-79 | None |
| A0A4P8A2H3 | 251-339 | None |
| A0A376Y619 | 41-123 | None |
| A0A3C0Z7U0 | 96-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.