DPCstruct | MC58742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 163 ± 24 aa |
| Standard deviation of domain lengths | 24.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023FXW8 | 1-168 | MLTIKEDKGTGVVTSVPSDSPDDFAALRDLKNKDALRQKYGVEDSMVLPFEPVPILEVPGYGSLCAAAVCEELKIQSQNDRDKLQEA… |
| A0A183F8Y2 | 41-176 | RVYALPMLTIKDDKGTGVVTSVPSDSPDDFAALSDLKKKKPLREKYGITDEMVVPFEPVPIIEIEGFGDLAAVEICRRMKIESQNEK… |
| S4R490 | 129-282 | None |
| A0A6V7S9Y3 | 477-604 | None |
| A0A803L6R5 | 258-448 | None |
| A0A6J5URJ2 | 47-217 | None |
| U4TYK5 | 28-171 | None |
| A0A177T541 | 17-187 | None |
| A0A7J7KUM2 | 145-294 | None |
| A0A7J7L5X6 | 2-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.