DPCstruct | MC58740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Standard deviation of domain lengths | 15.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2B1I3 | 3-90 | LARAWRSWLMRSAALLAGMRSGTTSVAEVFGRSGEELVKKTRVAQVLRAVPGYGHASVAALMAVSGVAEKRRVGGLTEQQRERLLQAL |
| A0A1G9P5E6 | 304-388 | AATPPPAAPTSRSQLREAVAAGQITLHALLSRTDPTTVGTPAGWLLRALPGRSPDAIAQTLQRAGIDSDADIGDLTLRQRNHLLA |
| A0A388NZN9 | 12-106 | None |
| A0A1Q3NEF7 | 3-92 | None |
| A0A4S2F4C0 | 612-705 | None |
| A0A538J1I5 | 5-105 | None |
| A0A7X8RPI6 | 6-103 | None |
| A0A7V9VNZ2 | 2-71 | None |
| A0A7V9KCF0 | 1-106 | None |
| G0HB63 | 122-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.