DPCstruct | MC5874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 148 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1Z505 | 17-179 | KKTSPTKFQEYRNELKQAIVEIFEENEPEKIRNASVIVGQIDNLGFSRQEYDKMNHIASMLPKLELSKTHDYREVVQLALDIVLQFI… |
| A0A3S7KN48 | 1-146 | MDEPDALLQDLLSGDATRIHASACRVAVTFDHTLLNALAPHADRIERACAGVTLGGALLANQVHLQAALQRLRYWQARTGCLCALAP… |
| A0A7T9E7A8 | 146-293 | None |
| A0A842WWQ1 | 18-173 | None |
| A0A3C0GQB7 | 17-166 | None |
| F9RG73 | 3-142 | None |
| A0A4Q3N9R9 | 2-128 | None |
| A0A7V8JII5 | 51-202 | None |
| A0A1G8GDV0 | 5-151 | None |
| A0A7M1SP37 | 338-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.