DPCstruct | MC58736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Standard deviation of domain lengths | 10.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8NRP0 | 1-73 | MGSLSQAGSGHAPGTEECEVCGSARLTRLHLALADGTDVTFVSCHECEHRAWFPLDGDGTSLSRDEVVRRSSR |
| A0A2W4PSJ1 | 2-55 | MDCQRCGQRNVLEIDHVLPDGTEVKFFFCHTCEEKWWDRDGVQIDLTEVLDIVR |
| D1BC81 | 1-66 | None |
| A0A3B0SQJ0 | 9-62 | None |
| A0A4Q5N427 | 53-126 | None |
| A0A7Y0H1Y3 | 27-98 | None |
| A0A510URU1 | 20-90 | None |
| A0A7K0NUE8 | 1-73 | None |
| A0A420XLM8 | 6-83 | None |
| A0LS28 | 65-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.