DPCstruct | MC58731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 188 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6I048 | 1-174 | MNNKFAALINCKTKRELTTLCKNIEVNSQEFTEFIIGCKMGLTRLNHVMHYFDFVPEHLETREDDWGILDADETTKKSSEGKKAIRR… |
| A0A1Q3U5W7 | 41-246 | VSINKDILHLKNPFLASSLSKEFHEKFANEKWAERYKQILATEIPPNFISLLTSQTKREQEKLLKGQSLTPMQLIALIFKAWTDFGY… |
| A0A2S6F2U6 | 8-183 | None |
| A0A514CE77 | 10-205 | None |
| A0A2X1BGI9 | 4-177 | None |
| A0A6L6NVR4 | 71-262 | None |
| A0A1F3Y887 | 36-224 | None |
| A0A1F8P1H2 | 42-234 | None |
| A0A5F2CX37 | 31-222 | None |
| A0A2K9PNR0 | 2-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.