DPCstruct | MC5873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Standard deviation of domain lengths | 20.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416ZAH6 | 10-186 | RIVERELKRTEEYQQRRDEYGNEEYILGCIMVKGDAFPKEVIAHAFVEDMGLELQFQVWRDEPRIRQKQAMWYDLTLFDVEGDFFGK… |
| A0A1Y4LVA5 | 2-160 | EKSKRKNMYLLANKKVHESLLFTNPYIKYVLMKNERKPQFIIGIYDVIDEINCVYEPHPDNAPVFLEDLEYKHHIFSEETEACEEGY… |
| A0A7X5R6X9 | 20-172 | None |
| A8R969 | 3-137 | None |
| D3AM55 | 81-207 | None |
| A0A3A6IKD0 | 182-342 | None |
| A0A413LTT9 | 2-156 | None |
| A0A6N3H695 | 119-264 | None |
| H1B7U9 | 152-305 | None |
| A0A3R6N0U6 | 6-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.