DPCstruct | MC58729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9PDI1 | 356-446 | FKNHPEHTPIGTWSSFEGKALSEEGGNKQQKDKPKTFVKLPSVLAGMEYKAEYIKRYNGNYARWYNANDLDAQEIYKEKLKGIKARI… |
| A0A5N7USU5 | 1-98 | MDFFTGDKNTTKKFFVSAVYENKGMSGQGGNKQVTDRKKEFVVLPSVLAGMEYKAFYIKKHNGNWAKWHSTKESNQKTYKTHIESIK… |
| A0A0T7AP64 | 888-981 | None |
| A0A1B9MZ61 | 337-432 | None |
| C3XJ84 | 186-284 | None |
| A0A3R5UUJ1 | 2-90 | None |
| A0A0W0LK12 | 283-377 | None |
| A0A1G8MTK2 | 259-355 | None |
| A0A8B2BP21 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.