DPCstruct | MC58720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 177 ± 28 aa |
| Standard deviation of domain lengths | 27.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0K6E1 | 2-153 | SAPDLARSIRRRLCDAEDNKEFVPDDAIQEFTSRNAVQTYLMANQQALPEDIAMQPLIDYVIDHDKPAKRVFLILELCNSMKYLTIL… |
| A0A194X2W8 | 2-179 | GIIQEDMPGKSLEDLPEELAEELLEEHVTLEVRLLRAQMALPRISEPYCIPQDNFDRVVNVDTILAELQRCGVTLAETELHEKTVEI… |
| G2YU74 | 144-311 | None |
| A0A135V8H5 | 102-286 | None |
| A0A3L6N4M6 | 13-161 | None |
| A0A423VFR6 | 1-165 | None |
| A0A484FCT3 | 51-225 | None |
| A0A6A5TGP2 | 200-381 | None |
| A0A135T363 | 577-744 | None |
| T0KQX2 | 8-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.