DPCstruct | MC5872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 483 ± 29 aa |
| Standard deviation of domain lengths | 28.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498P852 | 2-485 | TPTVWVRPRQGPKLADLIAEPDTTRAHGDSDVLDVAGSAYAATDGDPATAWTAPQRVVQYKSPPTLTVSLPRPTEVAGLRLLPSRSA… |
| A0A7Y2GKN9 | 38-559 | REFLLLGEARLSAYVDDALIDELVGIDPSSTVARSSERLAGDLPSRARAAVDADPTTAWQTPFDLVTEQWLELQTPQPTTIDTLTFS… |
| A0A4P7H536 | 17-479 | None |
| A0A6J6QAX6 | 429-901 | None |
| A0A4P7UCL7 | 283-737 | None |
| A0A7K1C8W1 | 545-1045 | None |
| A0A7J0CIS5 | 115-600 | None |
| A0A7K0RK21 | 584-1053 | None |
| A0A6J6MJB9 | 328-858 | None |
| A0A6J7NFZ5 | 696-1199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.