DPCstruct | MC58716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194WUW9 | 1-81 | MADAFPQDRSLRTSVRSTVLGENFVSIAFNADKAADPNAKLYINDYNLDSATYAKVTTGMVAHVKKWIAAGIPIDRISSQS |
| A0A1I0KNA7 | 161-236 | VWAWDVVNEAFNDDGSYRDSVWYQAMGTGFVDKAFWTARTADPAAKLVYNDYGIETINAKSDAVYAMIKGLLAKGV |
| A0A7G2E300 | 676-761 | None |
| A0A229XXG8 | 150-236 | None |
| R8BIZ5 | 15-94 | None |
| A0A842Z030 | 158-240 | None |
| A0A4Q4VIQ8 | 1-107 | None |
| G4TIH8 | 197-272 | None |
| A0A094GT16 | 198-275 | None |
| Q2H7X4 | 113-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.