DPCstruct | MC58705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 163 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3MDW9 | 305-476 | GYYMGKIYLFLQKIGMDMQRVRFRQHLPNEMAHYACDCWDCEIHSFHGWVECVGCADRACYDLVQHSTKSKQKLIAQENLTTPILIK… |
| X1B0T7 | 6-146 | YPKKFRFRKHGDDELAHYATECWDAELYSERFGWVECVGIADRSAYDLRSHIDSSGTDMYALRKYDEPKVVDVKKLVPNMGALGPLF… |
| U6L8U7 | 544-742 | None |
| A0A7J0GB65 | 130-272 | None |
| A0A6A6MGH4 | 189-334 | None |
| A0A7S0MC19 | 93-270 | None |
| A0A6I9YKN6 | 241-391 | None |
| A0A421JW65 | 916-1088 | None |
| A0A7S2V5Z6 | 1-145 | None |
| A0A2T6ZI75 | 62-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.