DPCstruct | MC58704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1ALL4 | 7-89 | QGLAAVLGGTQSLHTNSFDEALCLPTENAVKIALRTQQIIAHESGVTDTVDPLAGSYYVEWLTNKMDLPGADKKVADIMQMLE |
| A0A376NUT8 | 188-269 | LTEQDPYNNVIRTTIEALAATLGGTQSLHTNAFDEALGLPTDFSARIARNTQIIIQEESELCRTVDPLAGSYYIESLTDQIV |
| A0A376UFI3 | 68-155 | None |
| E1Y964 | 8-81 | None |
| A0A7C3F146 | 190-274 | None |
| A0A1M5X8J8 | 129-212 | None |
| P26947 | 45-132 | None |
| A0A0M3IVA6 | 302-371 | None |
| A0A6G3V9Z5 | 6-93 | None |
| A0A2T2XD31 | 10-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.