DPCstruct | MC58702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1AIF3 | 11-87 | DINMDISEDEAFELAKRYLAKTNMDEIVGDEVEKFYGYYTIHTLTENGDIAGMLSVNGFSGEVWYHNWHGIFIDMTE |
| Q466J6 | 58-146 | MWNTRFGAGRTRAGGTDYDLAGAQKLAEDFLTGYLPGAQIQESHAMPGYYTFDFGRNETEGMLSVNAFSGHIWVHTWHGPYLGEMNV… |
| A0A3N4YKZ8 | 235-319 | None |
| A0A7C3PAC1 | 106-197 | None |
| A0A497J4Z4 | 26-102 | None |
| A0A4R8GHK6 | 167-261 | None |
| A0A2A5BU12 | 22-107 | None |
| A0A3M1EGW0 | 6-88 | None |
| A0A369T9T4 | 158-245 | None |
| K2JBC3 | 2-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.