DPCstruct | MC587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 14.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8FN15 | 12-122 | YKKETYFLDMFGKVKHNHTTLYNDRNNCISEKHIERWLSMNDLLNVSIYLNEGWQPDWNNIQEKKYIIIVKNDTVSTQETDFPCSIT… |
| A0A2U7PG52 | 7-145 | EEITEEQNSIFNIKEGDIYYSICDDSDVESIIFENDSYDNKYIQSGNAFLTEKEAEKEVNRRKAIQRIKKYCFENNIQYKENVSDET… |
| A0A7W4HY97 | 32-154 | None |
| A0A1E9PIM1 | 4-155 | None |
| A0A2I1K248 | 39-197 | None |
| A0A844JQR6 | 71-199 | None |
| A0A7W4DRP7 | 57-186 | None |
| A0A225M3J9 | 1-167 | None |
| A0A857V7M7 | 56-191 | None |
| A0A661PKD5 | 44-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.