DPCstruct | MC58697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 204 ± 30 aa |
| Standard deviation of domain lengths | 30.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6H8G7 | 82-287 | FKSENMSLFEWMEDKGLQIGQSLSTALSEELMEYFGLKPFLNEEQCDRNEIPYRGAANGWNNSACPVSLSLPKIHSTISCVLSSQCT… |
| A0A8B6CRY2 | 28-199 | FKYGFSLMDWLSTTGLKNTTVLRDQALTDLNEVLGVIKYNQADECSKHMLPYSSSQPNGWNNECPSMPNSLNPLSSYIACYIPDHCT… |
| A0A8B6F2H3 | 247-457 | None |
| A0A6P4Y312 | 9-209 | None |
| A0A8B6C3A6 | 7-243 | None |
| A0A8B6BYA7 | 1-182 | None |
| A0A8B6BU98 | 630-812 | None |
| A0A8B6F6L5 | 627-855 | None |
| A0A8B6ESH6 | 3-184 | None |
| A0A6P4XXH8 | 258-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.