DPCstruct | MC58696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 17.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 66.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4RLV2 | 71-159 | PNKKPCGKKRGRRPSKIDLEAKLERSRQSARECRARKKLRYKYLEDMIADKETYVYKLREELEMYRRWCKAVDKGAYPAELLEFLKN… |
| A0A8B6CRJ7 | 1-117 | MTIDRSLRRPSKRPGRRTAKVDVKVKLERSRQSARECRARKKLRYQYLEDLVTSKEKAIFKLRDELALHRKICAEVDSGTISEIMFE… |
| A0A7F8QRL3 | 1-119 | None |
| A0A455BDL5 | 1-146 | None |
| A0A6P8IJZ7 | 69-161 | None |
| A0A4W3HZL5 | 330-423 | None |
| A0A0F8B0I2 | 1-127 | None |
| A0A6M2DJ30 | 9-116 | None |
| A0A667GCM8 | 15-135 | None |
| A0A671T849 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.