DPCstruct | MC58694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 84 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6CNR9 | 46-111 | MVTPDSMLISEITLFGEGFGNCKALAKKTYTLYSLAEQQLSKQDHYDFGLRALVSVLRYAGKKKRN |
| A0A3S4ZRK8 | 37-102 | MTQPDRQLIAQVMLYSQGFRTAENLANKVVPFFKLCDEQLSPQSHYDFGLRALKSVLVSAGNVKRE |
| U6LY51 | 1-66 | None |
| A0A2P8XYG1 | 206-278 | None |
| A0A812QHS2 | 406-520 | None |
| A0A1A9XJK6 | 5-98 | None |
| A0A086K731 | 126-191 | None |
| A0A836DAR7 | 3-79 | None |
| A0A5J4V6U6 | 24-91 | None |
| A0A1X7TCB0 | 85-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.