DPCstruct | MC58692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6CMS7 | 1-108 | MTFELRQPEPVYVKGRLVRGGPQMIQLSLDGKRLYVSSSLFSFWDQQFYPELITEGSQLFQIDVDTVNGGMTLNKNFLVDFGDEPNG… |
| F4FZV7 | 1-74 | MIEISRDGKRVYVTNSLYGTWDNQFYPEGLKGWMVKLNADGGLTVDKEFLVDFGEARAHQVRLRGGDASSDSYC |
| A0A812TWP6 | 990-1107 | None |
| A0A4S4DCV7 | 185-286 | None |
| A0A5N4AG49 | 24-142 | None |
| A0A6V7WN86 | 455-585 | None |
| A0A226NX16 | 150-249 | None |
| A0A0N4VB55 | 296-401 | None |
| A0A844MNL5 | 116-222 | None |
| A0A131YPQ2 | 168-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.