DPCstruct | MC5869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2DED1 | 1-50 | MQPPASITCVDCLGECRLLTYAPEDGFKPGDIVAYRCLDCLDRWDIELAE |
| A0A7T9FA96 | 1-53 | MVVPEPEIVCVDCGGPARLTSYPREDGTWWPGDIVTYRCRDCLDRWDLVLPDD |
| A0A2E1YBU8 | 9-65 | None |
| A0A4P5RTY6 | 25-81 | None |
| A0A7W1CM51 | 3-62 | None |
| A0A6J6DIA5 | 14-72 | None |
| A0A848WXI7 | 3-62 | None |
| A0A2E4RN03 | 27-82 | None |
| A0A0R2Q4R8 | 74-134 | None |
| A0A7Y1UN63 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.